Content: 1 mg IGF-1 LR3
Form: Lyophilized (freeze-dried) sterile powder
Appearance: White to off-white lyophilized powder
Purity: ≥ 98% (HPLC, supplier QC)
Storage: Store at 2–8 °C, protected from light & moisture
Shelf Life (Unreconstituted): Up to 24 months
Recommended Solvent (Research Use): Sterile or bacteriostatic water

Molecular Sequence

IGF-1 LR3 is a modified 83–amino acid analog of IGF-1 designed for enhanced receptor activity and reduced binding-protein interference.

Amino Acid Sequence:
MFPAMPLSSLRRAAALLAALCPGSFTTLAELARHSLDQTLVPETLCGGELVDTLQFVQQLRRHISAAFGRSQSLQNVLQFVRSQR
Length: 83 amino acids
Molecular Weight: ~9111 g/mol
Molecular Formula: C₃₈₄H₆₂₅N₁₁₁O₁₁₅S₉

Cellular growth and proliferation signaling
Protein synthesis and muscle-cell pathway modeling
IGF-1 receptor activation and metabolic cascade analysis
Tissue-repair and cellular-regeneration studies
Anti-catabolic mechanisms in controlled research environments

The LR3 modification enhances IGF-1 receptor affinity and reduces binding-protein interactions, enabling more predictable experimental results.

Total Content: 1 mg IGF-1 LR3
Appearance: Lyophilized powder
Purity: ≥ 98%
Storage: 2–8 °C (refrigerated, dry, dark)
Shelf Life: Up to 24 months

IGF-1 LR3 (1mg)

IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1) is a synthetic research peptide designed for laboratory studies exploring cellular growth pathways, protein synthesis, and metabolic signaling. Its modified structure allows enhanced receptor interaction and extended activity compared to native IGF-1, making it a valuable tool in controlled scientific environments.

For Research Use Only. Not for Human Consumption.

$90.00

Disclaimer

All products sold on this website are for laboratory research use only. They are not intended for human consumption, medical use, or cosmetic use. By purchasing, you confirm that you are a qualified researcher and understand the proper handling and storage procedures for research-grade materials. No medical claims are made or implied.