COA Verified

IGF-1 LR3 (1mg)

$90.00

IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1) is a synthetic research peptide designed for laboratory studies exploring cellular growth pathways, protein synthesis, and metabolic signaling. Its modified structure allows enhanced receptor interaction and extended activity compared to native IGF-1, making it a valuable tool in controlled scientific environments.

For Research Use Only. Not for Human Consumption.

Disclaimer

All products sold on this website are for laboratory research use only. They are not intended for human consumption, medical use, or cosmetic use. By purchasing, you confirm that you are a qualified researcher and understand the proper handling and storage procedures for research-grade materials. No medical claims are made or implied.

Purchase this product now and earn 90 Points!

Description

Product Details
  • Content: 1 mg IGF-1 LR3
  • Form: Lyophilized (freeze-dried) sterile powder
  • Appearance: White to off-white lyophilized powder
  • Purity: ≥ 98% (HPLC, supplier QC)
  • Storage: Store at 2–8 °C, protected from light & moisture
  • Shelf Life (Unreconstituted): Up to 24 months
  • Recommended Solvent (Research Use): Sterile or bacteriostatic water

Molecular Sequence

IGF-1 LR3 is a modified 83–amino acid analog of IGF-1 designed for enhanced receptor activity and reduced binding-protein interference.

  • Amino Acid Sequence:
    MFPAMPLSSLRRAAALLAALCPGSFTTLAELARHSLDQTLVPETLCGGELVDTLQFVQQLRRHISAAFGRSQSLQNVLQFVRSQR
  • Length: 83 amino acids
  • Molecular Weight: ~9111 g/mol
  • Molecular Formula: C₃₈₄H₆₂₅N₁₁₁O₁₁₅S₉
Research Focus
  • Cellular growth and proliferation signaling
  • Protein synthesis and muscle-cell pathway modeling
  • IGF-1 receptor activation and metabolic cascade analysis
  • Tissue-repair and cellular-regeneration studies
  • Anti-catabolic mechanisms in controlled research environments

The LR3 modification enhances IGF-1 receptor affinity and reduces binding-protein interactions, enabling more predictable experimental results.

Specification Summary
  • Total Content: 1 mg IGF-1 LR3
  • Appearance: Lyophilized powder
  • Purity: ≥ 98%
  • Storage: 2–8 °C (refrigerated, dry, dark)
  • Shelf Life: Up to 24 months

Additional information

Title

Default Title

Certificate of Analysis (COAs)

Title LOT# Size Published Testing COA
IGF-1 LR3N/A1mg2025-11-182025-11-17 View COA

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Tested Quality

Each peptide batch is rigorously tested through our third-party labs.

Trusted Source

We are a USA-based company and provide priority shipping to the USA.

You may also like…

  • COA Coming Soon

    reconstitution solution 30ml

    $35.00
0