Product details

Product name: LL-37
Quantity: 5 mg
Form: Lyophilized powder
Container: Sealed research vial
Peptide class: Human cathelicidin-derived host-defense peptide
Sequence length: 37 amino acids
Appearance: White to off-white lyophilized material
Purity: 99%+ when confirmed by the product’s batch-specific COA
Testing: Refer to the applicable Certificate of Analysis
Intended use: Laboratory research and analytical testing only
Human use: Not permitted
Prescription status: Not an approved drug or medication

Chemical information

Full name: Human cathelicidin antimicrobial peptide LL-37
Alternative names: LL37, Cathelicidin LL-37, hCAP18-derived peptide, CAP-18
PubChem CID: 16198951
Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃
Molecular weight: Approximately 4,493 g/mol
Peptide length: 37 amino acids
Peptide structure: Linear, cationic, amphipathic peptide with environment-dependent α-helical characteristics
Amino-acid sequence:
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Technical identifiers are supported by PubChem and the reviewed human cathelicidin entry from UniProt.

Composition

Each vial contains:

LL-37 peptide: 5 mg
Form: Lyophilized research material

Any excipients, counterions, residual solvents, or other batch-specific details should be listed according to the applicable Certificate of Analysis rather than assumed.

For research use only. Not for human or veterinary use. Not intended for ingestion, injection, diagnosis, treatment, prevention, or cure of any disease. This product has not been evaluated or approved by the FDA for clinical use.

Storage

Store the unopened vial in a cool, dry environment away from direct light. After reconstitution, follow established laboratory storage protocols and the information provided with the product.

Important Notice

This product is intended strictly for laboratory research and analytical purposes only. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention, or cure of any disease or medical condition. Not for use in food, drugs, cosmetics, or household products. Purchasers must be qualified researchers and are responsible for proper handling, storage, and use in accordance with all applicable laws and regulations.

Intended Use

This product is intended exclusively for:

Laboratory research
Analytical testing
In vitro experimentation
Preclinical investigative studies

Handling Guidelines

Handle using appropriate laboratory safety procedures
Utilize proper protective equipment (PPE) during handling
Reconstitute and store according to standard laboratory protocols
Avoid repeated freeze-thaw cycles

Storage Conditions

Store in a cool, dry, and dark environment
Refrigeration recommended for extended storage
Ensure vial remains tightly sealed when not in use

Quality Assurance

Each batch is subject to internal quality control procedures, which may include:

Purity verification
Identity confirmation
Visual inspection

Documentation such as Certificates of Analysis (COA) may be available upon request.

Compliance Notice

For Research Use Only
Not for human or veterinary use
Not intended to diagnose, treat, cure, or prevent any disease
Not a drug, food, or cosmetic product

This product is sold strictly for use by qualified professionals in controlled research settings.

Purchaser Acknowledgment

By purchasing this product, the buyer confirms that:

They are a qualified researcher or purchasing on behalf of one
They understand the nature of research-use-only materials
They will comply with all applicable laws and regulations regarding handling and use

HappyPeps maintains strict sourcing and handling standards to ensure consistency and reliability across all research materials.

LL-37 5 mg — Research Peptide

Product title

LL-37 5 mg | Lyophilized Research Peptide

Short description

LL-37 is a synthetic, 37-amino-acid research peptide modeled after the naturally occurring human cathelicidin peptide. It is studied in laboratory settings for its interactions with microbial membranes, innate immune signaling, inflammatory pathways, cellular migration, and tissue-repair mechanisms.

Supplied as 5 mg of lyophilized powder in a sealed research vial.

Full product description

LL-37 is a cationic, amphipathic peptide consisting of 37 amino-acid residues. It is the active C-terminal peptide derived from the human cathelicidin antimicrobial protein, also known as hCAP18.

The name LL-37 refers to its two N-terminal leucine residues—“LL”—and its total length of 37 amino acids. In experimental environments, LL-37 is extensively studied as a host-defense peptide because of its ability to interact with biological membranes and participate in several innate immune processes.

Current research examines LL-37 in connection with microbial membrane disruption, biofilm models, chemotactic signaling, cytokine regulation, angiogenic pathways, cellular migration, and experimental tissue-repair responses. Its biological activity can vary depending on concentration, experimental model, solution conditions, and the presence of salts, serum, or other biological components.

This product is supplied as a lyophilized powder and is intended exclusively for qualified laboratory research and analytical applications.

Research focus

LL-37 is commonly investigated in laboratory models involving:

Host-defense and innate immune signaling
Peptide–membrane interactions
Bacterial membrane permeability
Experimental bacterial and fungal models
Biofilm formation and disruption
Cytokine and inflammatory signaling
Chemotaxis and immune-cell recruitment
Keratinocyte and epithelial-cell migration
Angiogenic signaling pathways
Experimental wound-closure mechanisms
Structure–activity relationships
Development of LL-37-derived peptide analogues

LL-37 has complex, context-dependent biological behavior. Experimental findings should not be interpreted as evidence of safety or effectiveness in humans.

LL-37 . 5MG

$50.00

Disclaimer

All products sold on this website are for laboratory research use only. They are not intended for human consumption, medical use, or cosmetic use. By purchasing, you confirm that you are a qualified researcher and understand the proper handling and storage procedures for research-grade materials. No medical claims are made or implied.

Tested Quality

Each peptide batch is rigorously tested through our third-party labs.

Trusted Source

We are a USA-based company and provide priority shipping to the USA.

Don’t Forget!

To add your extras.

Product Details