Description
Product Details
- Content: 1 mg IGF-1 LR3
- Form: Lyophilized (freeze-dried) sterile powder
- Appearance: White to off-white lyophilized powder
- Purity: ≥ 98% (HPLC, supplier QC)
- Storage: Store at 2–8 °C, protected from light & moisture
- Shelf Life (Unreconstituted): Up to 24 months
- Recommended Solvent (Research Use): Sterile or bacteriostatic water
Molecular Sequence
IGF-1 LR3 is a modified 83–amino acid analog of IGF-1 designed for enhanced receptor activity and reduced binding-protein interference.
- Amino Acid Sequence:
MFPAMPLSSLRRAAALLAALCPGSFTTLAELARHSLDQTLVPETLCGGELVDTLQFVQQLRRHISAAFGRSQSLQNVLQFVRSQR - Length: 83 amino acids
- Molecular Weight: ~9111 g/mol
- Molecular Formula: C₃₈₄H₆₂₅N₁₁₁O₁₁₅S₉
Research Focus
- Cellular growth and proliferation signaling
- Protein synthesis and muscle-cell pathway modeling
- IGF-1 receptor activation and metabolic cascade analysis
- Tissue-repair and cellular-regeneration studies
- Anti-catabolic mechanisms in controlled research environments
The LR3 modification enhances IGF-1 receptor affinity and reduces binding-protein interactions, enabling more predictable experimental results.
Specification Summary
- Total Content: 1 mg IGF-1 LR3
- Appearance: Lyophilized powder
- Purity: ≥ 98%
- Storage: 2–8 °C (refrigerated, dry, dark)
- Shelf Life: Up to 24 months







There are no reviews yet.